Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8J1 Peptide - C-terminal region

OR8J1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR8J1

UniProt

Q8NGP2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8J1 Rabbit Polyclonal Antibody (orb587652) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005205

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPETVVFISAATNVVGSLIIVLVSYFNIVLSILKICSSEGRKKAFSTCAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse ET-1 (Endothelin1) ELISA Kit
ELK2397-01 48 Tests

Mouse ET-1 (Endothelin1) ELISA Kit

Sign In for Pricing
View Details
Mouse ET-1 (Endothelin1) ELISA Kit
ELK2397-02 96 Tests

Mouse ET-1 (Endothelin1) ELISA Kit

Sign In for Pricing
View Details
Mouse ET-1 (Endothelin1) ELISA Kit
ELK2397-03 5x 96 Tests

Mouse ET-1 (Endothelin1) ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Pak3 shRNA (UAS) - Lentiviral mouse Pak3 shRNA (UAS, GFP) (100)
GTR15247065 1 Vial

Lentiviral mouse Pak3 shRNA (UAS) - Lentiviral mouse Pak3 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
MtTMPK-IN-1
MBS5804494 Inquire

MtTMPK-IN-1

Sign In for Pricing
View Details
1,2-Dioleoyl-3-Bromopropanediol
MBS3920401-01 25 mg

1,2-Dioleoyl-3-Bromopropanediol

Sign In for Pricing
View Details