Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRRT4 Peptide - N-terminal region

PRRT4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PRRT4

UniProt

C9JH25

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRRT4 Rabbit Polyclonal Antibody (orb587719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005250401

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTEWGSTEGGSKPRASSLLPESTSRRSGPSDGPTAPYQPRRSTVTWDTAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cacng7 Mouse qPCR Primer Pair (NM_133189)
MP201571 200 Reactions

Cacng7 Mouse qPCR Primer Pair (NM_133189)

Sign In for Pricing
View Details
SMC4 Blocking Peptide
33R-8489 100 ug

SMC4 Blocking Peptide

Sign In for Pricing
View Details
Mouse GIPR Protein, hFc Tag
MBS189736-01 0.01 mg

Mouse GIPR Protein, hFc Tag

Sign In for Pricing
View Details
Mouse GIPR Protein, hFc Tag
MBS189736-02 0.05 mg

Mouse GIPR Protein, hFc Tag

Sign In for Pricing
View Details
Mouse GIPR Protein, hFc Tag
MBS189736-03 0.1 mg

Mouse GIPR Protein, hFc Tag

Sign In for Pricing
View Details
Mouse GIPR Protein, hFc Tag
MBS189736-04 5x 0.1 mg

Mouse GIPR Protein, hFc Tag

Sign In for Pricing
View Details