Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRRT4 Peptide - N-terminal region

PRRT4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PRRT4

UniProt

C9JH25

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRRT4 Rabbit Polyclonal Antibody (orb587719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005250401

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LTEWGSTEGGSKPRASSLLPESTSRRSGPSDGPTAPYQPRRSTVTWDTAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Histone Deacetylase 3 (HDAC3) ELISA kit
BSKH63019-01 48 Tests

Human Histone Deacetylase 3 (HDAC3) ELISA kit

Sign In for Pricing
View Details
Human Histone Deacetylase 3 (HDAC3) ELISA kit
BSKH63019-02 96 Tests

Human Histone Deacetylase 3 (HDAC3) ELISA kit

Sign In for Pricing
View Details
Rabbit N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit
abx155094-01 96 Tests

Rabbit N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit

Sign In for Pricing
View Details
Rabbit N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit
abx155094-02 5x 96 Tests

Rabbit N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit

Sign In for Pricing
View Details
Rabbit N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit
abx155094-03 10x 96 Tests

Rabbit N-Terminal Pro-Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit

Sign In for Pricing
View Details
Human IL-12/23 P40 ELISA kit
E22-HC152.48 48 Tests

Human IL-12/23 P40 ELISA kit

Sign In for Pricing
View Details