Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CFI Peptide - C-terminal region

CFI Peptide - C-terminal region

Product Specifications

Product Name Alternative

CFI, IF

UniProt

P05156

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CFI Rabbit Polyclonal Antibody (orb587721) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000195

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWGENCGKPEFPGVYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANTES (CCL5) (AK092450) Human Untagged Clone
SC102926 10 µg

RANTES (CCL5) (AK092450) Human Untagged Clone

Sign In for Pricing
View Details
RGD1565283 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6038003 1.0 µg DNA

RGD1565283 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Recombinant human Frizzled-5 Protein
MBS9141887-01 0.01 mg

Recombinant human Frizzled-5 Protein

Sign In for Pricing
View Details
Recombinant human Frizzled-5 Protein
MBS9141887-02 0.02 mg

Recombinant human Frizzled-5 Protein

Sign In for Pricing
View Details
Recombinant human Frizzled-5 Protein
MBS9141887-03 0.05 mg

Recombinant human Frizzled-5 Protein

Sign In for Pricing
View Details
Recombinant human Frizzled-5 Protein
MBS9141887-04 0.1 mg

Recombinant human Frizzled-5 Protein

Sign In for Pricing
View Details