Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS42 Peptide - C-terminal region

PRSS42 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PRSS42, TESSP2

UniProt

Q7Z5A4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS42 Rabbit Polyclonal Antibody (orb587722) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_874361

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TSNIQPICIPQENFQVEGRTRCWVTGWGKTPEREKLASEILQDVDQYIMC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEIG1 (Center) Rabbit Polyclonal Antibody
AP52663PU-N 400 µL

MEIG1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ESD Mouse Monoclonal Antibody [J0-8]
M1510-1 100 µL

ESD Mouse Monoclonal Antibody [J0-8]

Sign In for Pricing
View Details
FOXP4 Antibody (Biotin)
KB-23238-01 50 μL

FOXP4 Antibody (Biotin)

Sign In for Pricing
View Details
FOXP4 Antibody (Biotin)
KB-23238-02 100 µL

FOXP4 Antibody (Biotin)

Sign In for Pricing
View Details
FOXP4 Antibody (Biotin)
KB-23238-03 1 mL

FOXP4 Antibody (Biotin)

Sign In for Pricing
View Details
Glycerol-13C3
TRC-G598403-10MG 10 mg

Glycerol-13C3

Sign In for Pricing
View Details