PYROXD1 Peptide - middle region
PYROXD1 Peptide - middle region
Product Specifications
Product Name Alternative
PYROXD1
UniProt
Q8WU10
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PYROXD1 Rabbit Polyclonal Antibody (orb587729) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079130
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EKSEAKIAHKRTRYTTEGRKKEARSKSKADNVGSALGPDWHEGLNLKGTK
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6376346-01 0.1 mL
DLX4 (Distal-less Homeobox 4, DII Family Homeodomain Transcription Factor) (MaxLight 750)
Sign In for Pricing
View Details 
MBS6376346-02 5x 0.1 mL
DLX4 (Distal-less Homeobox 4, DII Family Homeodomain Transcription Factor) (MaxLight 750)
Sign In for Pricing
View Details NBP1-96981UV 0.5 mL
Mouse Monoclonal Mouse IgG2a Isotype Control (M2AK) [DyLight 350]
Sign In for Pricing
View Details RC205593L1V 200 µL
IMP5 (SPPL2C) (NM_175882) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details