Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYROXD1 Peptide - middle region

PYROXD1 Peptide - middle region

Product Specifications

Product Name Alternative

PYROXD1

UniProt

Q8WU10

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PYROXD1 Rabbit Polyclonal Antibody (orb587729) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079130

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKSEAKIAHKRTRYTTEGRKKEARSKSKADNVGSALGPDWHEGLNLKGTK

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKG2D Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-0938R-BF350-TR 20 µL

NKG2D Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Tim9B siRNA (h)
sc-41253 10 µM

Tim9B siRNA (h)

Sign In for Pricing
View Details
ApoL4 Polyclonal Antibody
E44H03996 100 µL

ApoL4 Polyclonal Antibody

Sign In for Pricing
View Details
EIF4A1P7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV760633 1.0 µg DNA

EIF4A1P7 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
SPA13 Polyclonal Antibody
BT-AP14402-01 20 µL

SPA13 Polyclonal Antibody

Sign In for Pricing
View Details
SPA13 Polyclonal Antibody
BT-AP14402-02 50 µL

SPA13 Polyclonal Antibody

Sign In for Pricing
View Details