Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCTEX1D2 Peptide - C-terminal region

TCTEX1D2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TCTEX1D2

UniProt

E7ESA3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCTEX1D2 Rabbit Polyclonal Antibody (orb587768) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELANAEYSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,4,5,5-Tetramethyl-2-{3-[ (methylsulfanyl) methyl]phenyl}-1,3,2-dioxaborolane
PGC92365-01 50 mg

4,4,5,5-Tetramethyl-2-{3-[ (methylsulfanyl) methyl]phenyl}-1,3,2-dioxaborolane

Sign In for Pricing
View Details
4,4,5,5-Tetramethyl-2-{3-[ (methylsulfanyl) methyl]phenyl}-1,3,2-dioxaborolane
PGC92365-02 0.5 g

4,4,5,5-Tetramethyl-2-{3-[ (methylsulfanyl) methyl]phenyl}-1,3,2-dioxaborolane

Sign In for Pricing
View Details
Moesin (rMSN/492), CF405S conjugate, 0.1mg/mL
BNC042307-500 1x 500 µL

Moesin (rMSN/492), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyp4b1 ORF Vector (Rat) (pORF)
ORF065733 1.0 µg DNA

Cyp4b1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
CKLFH6 Rabbit pAb
E47R8025 100 µL

CKLFH6 Rabbit pAb

Sign In for Pricing
View Details
Mouse Anti-Canine Pantothenate Kinase 2 (PANK2) Monoclonal Antibody
VD11N58 1 Each

Mouse Anti-Canine Pantothenate Kinase 2 (PANK2) Monoclonal Antibody

Sign In for Pricing
View Details