Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCTEX1D2 Peptide - C-terminal region

TCTEX1D2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TCTEX1D2

UniProt

E7ESA3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TCTEX1D2 Rabbit Polyclonal Antibody (orb587768) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELANAEYSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NK-3R (m) -PR
sc-42295-PR 10 µM - 20 µL

NK-3R (m) -PR

Sign In for Pricing
View Details
Rat Free fatty acid receptor 2 (FFAR2) ELISA Kit
RK14423 96 Tests

Rat Free fatty acid receptor 2 (FFAR2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal PGD2 Synthase/PTGDS Antibody [DyLight 488]
NBP3-00115G 0.1 mL

Rabbit Polyclonal PGD2 Synthase/PTGDS Antibody [DyLight 488]

Sign In for Pricing
View Details
EAUDIST.CH.355X37CARD-T1-P16 Pipe Markers for Water
N003509 3 Card (3 Marker (s) x 1 Card)

EAUDIST.CH.355X37CARD-T1-P16 Pipe Markers for Water

Sign In for Pricing
View Details
Phosphonic acid, P- (5-chloro-2-hydroxyphenyl) -, diethyl ester
JH913474 1 Each

Phosphonic acid, P- (5-chloro-2-hydroxyphenyl) -, diethyl ester

Sign In for Pricing
View Details
JKAMP (NM_001284204) Human Tagged ORF Clone
RG236614 10 µg

JKAMP (NM_001284204) Human Tagged ORF Clone

Sign In for Pricing
View Details