Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL24 Peptide - C-terminal region

METTL24 Peptide - C-terminal region

Product Specifications

Product Name Alternative

METTL24, C6orf186

UniProt

Q5JXM2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with METTL24 Rabbit Polyclonal Antibody (orb327154) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001116836

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EWKVLENLILEDVLEQIGQLIFEIHLHWPGFEVSGSDSSVVRFWYSLLKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PWWP2A Human Gene Knockout Kit (CRISPR)
KN422777 1 Kit

PWWP2A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-(Trifluoroacetyl)hexanolamine
TRC-T788050-1G 1 g

N-(Trifluoroacetyl)hexanolamine

Sign In for Pricing
View Details
DMC1 (N-term) Rabbit Polyclonal Antibody
AP51277PU-N 400 µL

DMC1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Flt3l (BC019801) Mouse Tagged ORF Clone
MG201410 10 µg

Flt3l (BC019801) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human TRAPPC1 activation kit by CRISPRa
GA111768 1 Kit

Human TRAPPC1 activation kit by CRISPRa

Sign In for Pricing
View Details
Dusp1 Mouse Gene Knockout Kit (CRISPR)
KN304862LP 1 Kit

Dusp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details