METTL24 Peptide - C-terminal region
METTL24 Peptide - C-terminal region
Product Specifications
Product Name Alternative
METTL24, C6orf186
UniProt
Q5JXM2
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with METTL24 Rabbit Polyclonal Antibody (orb327154) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001116836
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EWKVLENLILEDVLEQIGQLIFEIHLHWPGFEVSGSDSSVVRFWYSLLKE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP307752M 100 µg
NKX2.8 (NKX2-8) (NM_014360) Human Recombinant Protein
Sign In for Pricing
View Details 
TA369972 100 µL
Chloride Channel 5 (CLCN5) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 