Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPOP Peptide - C-terminal region

EPOP Peptide - C-terminal region

Product Specifications

Product Name Alternative

PRR28, C17orf96

UniProt

A6NHQ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPOP Rabbit Polyclonal Antibody (orb327159) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001124149

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRTAQPRRPAPTLPTTSTFSLLNCFPCPPALVVGEDGDLKPASSLRLQGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NM23-H1 Antibody : FITC (OAAF05874-FITC)
OAAF05874-100UG-FITC 100 µg

NM23-H1 Antibody : FITC (OAAF05874-FITC)

Sign In for Pricing
View Details
GSTA5 (NM_153699) Human Over-expression Lysate
LC406983 20 µg

GSTA5 (NM_153699) Human Over-expression Lysate

Sign In for Pricing
View Details
mmu-miR-5125 miRNA Inhibitor
MBS8296455-01 10 nmol

mmu-miR-5125 miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-5125 miRNA Inhibitor
MBS8296455-02 20 nmol

mmu-miR-5125 miRNA Inhibitor

Sign In for Pricing
View Details
mmu-miR-5125 miRNA Inhibitor
MBS8296455-03 5x 20 nmol

mmu-miR-5125 miRNA Inhibitor

Sign In for Pricing
View Details
Guinea pig Thrombin Sensitive Protein 1 ELISA Kit
MBS732847-01 48 Well

Guinea pig Thrombin Sensitive Protein 1 ELISA Kit

Sign In for Pricing
View Details