Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPOP Peptide - C-terminal region

EPOP Peptide - C-terminal region

Product Specifications

Product Name Alternative

PRR28, C17orf96

UniProt

A6NHQ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPOP Rabbit Polyclonal Antibody (orb327159) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001124149

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRTAQPRRPAPTLPTTSTFSLLNCFPCPPALVVGEDGDLKPASSLRLQGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human cytochrome P450 7A1, CYP7A1 ELISA Kit
MBS166352-01 48 Well

Human cytochrome P450 7A1, CYP7A1 ELISA Kit

Sign In for Pricing
View Details
Human cytochrome P450 7A1, CYP7A1 ELISA Kit
MBS166352-02 96 Well

Human cytochrome P450 7A1, CYP7A1 ELISA Kit

Sign In for Pricing
View Details
Human cytochrome P450 7A1, CYP7A1 ELISA Kit
MBS166352-03 5x 96 Well

Human cytochrome P450 7A1, CYP7A1 ELISA Kit

Sign In for Pricing
View Details
Human cytochrome P450 7A1, CYP7A1 ELISA Kit
MBS166352-04 10x 96 Well

Human cytochrome P450 7A1, CYP7A1 ELISA Kit

Sign In for Pricing
View Details
Anti-Human IgG Fc Fragment Antibody (R2X62)
RHB96402 100 μg

Anti-Human IgG Fc Fragment Antibody (R2X62)

Sign In for Pricing
View Details
C.I. Acid black 60
HY-D0480 1 Each

C.I. Acid black 60

Sign In for Pricing
View Details