Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUTM2B Peptide - middle region

NUTM2B Peptide - middle region

Product Specifications

Product Name Alternative

NUTM2B, FAM22B

UniProt

A6NNL0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUTM2B Rabbit Polyclonal Antibody (orb327166) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005270193

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EIPPEVVQEYVDIMEELLGPSLGATGEPEKQREEGKVKQPQEEDWTPPDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLVCR1 Rabbit Polyclonal Antibody
orb325948 100 µL

FLVCR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Rcor2 Pre-designed siRNA Set A
SI211754A 1 Each

Rat Rcor2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
KCTD20 3'UTR Luciferase Stable Cell Line
TU011577 1.0 mL

KCTD20 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
RAP80, Control Peptide (BRCA1-A Complex Subunit RAP80, Receptor-associated Protein 80, Retinoid X Receptor-interacting Protein 110, Ubiquitin Interaction Motif-containing Protein 1, UIMC1, RXRIP110)
147335 50 µg

RAP80, Control Peptide (BRCA1-A Complex Subunit RAP80, Receptor-associated Protein 80, Retinoid X Receptor-interacting Protein 110, Ubiquitin Interaction Motif-containing Protein 1, UIMC1, RXRIP110)

Sign In for Pricing
View Details
Tubulin (HRP)
MBS6243944-01 0.1 mL

Tubulin (HRP)

Sign In for Pricing
View Details
Tubulin (HRP)
MBS6243944-02 5x 0.1 mL

Tubulin (HRP)

Sign In for Pricing
View Details