Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUTM2B Peptide - middle region

NUTM2B Peptide - middle region

Product Specifications

Product Name Alternative

NUTM2B, FAM22B

UniProt

A6NNL0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUTM2B Rabbit Polyclonal Antibody (orb327166) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005270193

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EIPPEVVQEYVDIMEELLGPSLGATGEPEKQREEGKVKQPQEEDWTPPDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tripple Range Current Meter MR-100
1091650/9 1 Each

Tripple Range Current Meter MR-100

Sign In for Pricing
View Details
Prostatic Binding Protein, ID (PBP, Hippocampal Cholinergic Neurostimulating Peptide, HCNP, HCNPpp, Neuropolypeptide h3, Phosphatidylethanolamine Binding Protein, PEBP, Phosphatidylethanolamine Binding Protein 1, PEBP1, PEBP-1, Raf Kinase Inhibitory Protein, RKIP) (MaxLight 750) discontinued
P9054-78H-ML750 100 µL

Prostatic Binding Protein, ID (PBP, Hippocampal Cholinergic Neurostimulating Peptide, HCNP, HCNPpp, Neuropolypeptide h3, Phosphatidylethanolamine Binding Protein, PEBP, Phosphatidylethanolamine Binding Protein 1, PEBP1, PEBP-1, Raf Kinase Inhibitory Protein, RKIP) (MaxLight 750) discontinued

Sign In for Pricing
View Details
LOC691485 3'UTR GFP Stable Cell Line
TU262349 1.0 mL

LOC691485 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Npy5r shRNA (UAS) - Lentiviral mouse Npy5r shRNA (UAS, GFP) (100)
GTR15220881 1 Vial

Lentiviral mouse Npy5r shRNA (UAS) - Lentiviral mouse Npy5r shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Temocapril hydrochloride
289948-01 5 mg

Temocapril hydrochloride

Sign In for Pricing
View Details
Temocapril hydrochloride
289948-02 10 mg

Temocapril hydrochloride

Sign In for Pricing
View Details