Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSFX2 Peptide - C-terminal region

HSFX2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSFX2

UniProt

Q9UBD0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSFX2 Rabbit Polyclonal Antibody (orb327174) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057237

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGAAQPAASMVMFPHLPALHHHCPHSHRTSQYMPASDGPQAYPDYADQST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-CKAP4-3×Myc-Neo Plasmid
PVT63073 2 µg

pCMV-CKAP4-3×Myc-Neo Plasmid

Sign In for Pricing
View Details
GABAB R1 Polyclonal Antibody
JOT-AP03433-01 20 µL

GABAB R1 Polyclonal Antibody

Sign In for Pricing
View Details
GABAB R1 Polyclonal Antibody
JOT-AP03433-02 50 μL

GABAB R1 Polyclonal Antibody

Sign In for Pricing
View Details
GABAB R1 Polyclonal Antibody
JOT-AP03433-03 100 µL

GABAB R1 Polyclonal Antibody

Sign In for Pricing
View Details
Nkx1-2 ORF Vector (Rat) (pORF)
31877016 1.0 µg DNA

Nkx1-2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
MEF2C (S59) (Myocyte-specific Enhancer Factor 2C) (MaxLight 405) discontinued
M9769-97G-ML405 100 µL

MEF2C (S59) (Myocyte-specific Enhancer Factor 2C) (MaxLight 405) discontinued

Sign In for Pricing
View Details