Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSFX2 Peptide - C-terminal region

HSFX2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HSFX2

UniProt

Q9UBD0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSFX2 Rabbit Polyclonal Antibody (orb327174) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057237

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGAAQPAASMVMFPHLPALHHHCPHSHRTSQYMPASDGPQAYPDYADQST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Tau Rabbit Monoclonal Antibody
E56G2454 100 µL

Phospho-Tau Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
USP20 (NM_001110303) Human Untagged Clone
SC328028 10 µg

USP20 (NM_001110303) Human Untagged Clone

Sign In for Pricing
View Details
CHTF18 Rabbit Polyclonal Antibody
TA344703 100 µL

CHTF18 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Freedom Rocker BlotBot 248V
FRB248V.G 1 Each

Freedom Rocker BlotBot 248V

Sign In for Pricing
View Details
ITIH1 Antibody (FITC)
orb686510-01 50 μL

ITIH1 Antibody (FITC)

Sign In for Pricing
View Details
ITIH1 Antibody (FITC)
orb686510-02 100 µL

ITIH1 Antibody (FITC)

Sign In for Pricing
View Details