Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIPL1 Peptide - C-terminal region

AIPL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AIPL1, hCG_32821

UniProt

F1T0C4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AIPL1 Rabbit Polyclonal Antibody (orb587937) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLDELQKEPQPLVFVIELLQVDAPSDYQRETWNLSNHEKMKAVPVLHGEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MS4A6D CRISPR Activation Plasmid (m)
sc-427175-ACT 20 µg

MS4A6D CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Anti-TGM1 Antibody
STJ503240 100 µg

Anti-TGM1 Antibody

Sign In for Pricing
View Details
Human Coatomer subunit zeta-1, COPZ1 ELISA Kit
MBS9340172-01 48 Well

Human Coatomer subunit zeta-1, COPZ1 ELISA Kit

Sign In for Pricing
View Details
Human Coatomer subunit zeta-1, COPZ1 ELISA Kit
MBS9340172-02 96 Well

Human Coatomer subunit zeta-1, COPZ1 ELISA Kit

Sign In for Pricing
View Details
Human Coatomer subunit zeta-1, COPZ1 ELISA Kit
MBS9340172-03 5x 96 Well

Human Coatomer subunit zeta-1, COPZ1 ELISA Kit

Sign In for Pricing
View Details
Human Coatomer subunit zeta-1, COPZ1 ELISA Kit
MBS9340172-04 10x 96 Well

Human Coatomer subunit zeta-1, COPZ1 ELISA Kit

Sign In for Pricing
View Details