Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AIPL1 Peptide - C-terminal region

AIPL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AIPL1, hCG_32821

UniProt

F1T0C4

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AIPL1 Rabbit Polyclonal Antibody (orb587937) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLDELQKEPQPLVFVIELLQVDAPSDYQRETWNLSNHEKMKAVPVLHGEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sturdy carrying case made of hard plastic (340 x 230 x 90 mm)
HI710032 1 Each

Sturdy carrying case made of hard plastic (340 x 230 x 90 mm)

Sign In for Pricing
View Details
Neuropeptide B-29 (NPB-29) (Human) - Antibody
H-005-51 50 μL

Neuropeptide B-29 (NPB-29) (Human) - Antibody

Sign In for Pricing
View Details
LOC100365112 siRNA Oligos set (Rat)
27009176 3x 5 nmol

LOC100365112 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Recombinant Human GM-CSF/CSF2 (P. pastoris)
C040-500ug 500 µg

Recombinant Human GM-CSF/CSF2 (P. pastoris)

Sign In for Pricing
View Details
DNA Coating Solution, with 96-well Plate
AKR-5182 10 mL

DNA Coating Solution, with 96-well Plate

Sign In for Pricing
View Details
General Transcription Factor II-I (GTF2I) Antibody
abx238630 100 µg

General Transcription Factor II-I (GTF2I) Antibody

Sign In for Pricing
View Details