PLCG2 Peptide - middle region
PLCG2 Peptide - middle region
Product Specifications
Product Name Alternative
PLCG2
UniProt
P16885
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLCG2 Rabbit Polyclonal Antibody (orb587945) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002652
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ETHLRCAEFELRLTDPVPNPNPHESKPWYYDSLSRGEAEDMLMRIPRDGA
More Discoveries
Explore Other Products
Browse additional items from our catalog
PB9949-FITC 100 µg/Vial
Anti-Integrin linked ILK Antibody Picoband® (FITC Conjugate)
Sign In for Pricing
View Details MBS6456406-01 0.1 mL
Gpr68 (Ovarian Cancer G-Protein Coupled Receptor 1, G-Protein Coupled Receptor 68, Sphingosylphosphorylcholine Receptor, Gpr68, Ogr1) (Biotin)
Sign In for Pricing
View Details