Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK12 Peptide - C-terminal region

MAPK12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MAPK12, ERK6, SAPK3

UniProt

P53778

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPK12 Rabbit Polyclonal Antibody (orb587949) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002960

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SIL1
MBS145217-01 0.002 mg

Recombinant Human SIL1

Sign In for Pricing
View Details
Recombinant Human SIL1
MBS145217-02 0.01 mg

Recombinant Human SIL1

Sign In for Pricing
View Details
Recombinant Human SIL1
MBS145217-03 0.1 mg

Recombinant Human SIL1

Sign In for Pricing
View Details
Recombinant Human SIL1
MBS145217-04 5x 0.1 mg

Recombinant Human SIL1

Sign In for Pricing
View Details
Vascular endothelial growth factor A Polyclonal Conjugated Antibody
orb1617708 100 µL

Vascular endothelial growth factor A Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Phospho-RPS6KB1 (Thr421/Ser424) Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-62970R-BF647 100 µL

Phospho-RPS6KB1 (Thr421/Ser424) Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details