Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB9 Peptide - middle region

SERPINB9 Peptide - middle region

Product Specifications

Product Name Alternative

SERPINB9, PI9

UniProt

P50453

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINB9 Rabbit Polyclonal Antibody (orb331414) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005249241

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-ZFP106 Antibody, Affinity Purified
MBS3902007-01 0.002 mg

Rabbit anti-ZFP106 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-ZFP106 Antibody, Affinity Purified
MBS3902007-02 0.02 mg

Rabbit anti-ZFP106 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-ZFP106 Antibody, Affinity Purified
MBS3902007-03 5x 0.002 mg

Rabbit anti-ZFP106 Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-ZFP106 Antibody, Affinity Purified
MBS3902007-04 5x 0.02 mg

Rabbit anti-ZFP106 Antibody, Affinity Purified

Sign In for Pricing
View Details
Dezamizumab (Reference antibody)
E55B0578 100 µg

Dezamizumab (Reference antibody)

Sign In for Pricing
View Details
PCM1 Lentiviral Activation Particles (h2)
sc-401360-LAC-2 200 µL

PCM1 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details