Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SERPINB9 Peptide - middle region

SERPINB9 Peptide - middle region

Product Specifications

Product Name Alternative

SERPINB9, PI9

UniProt

P50453

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SERPINB9 Rabbit Polyclonal Antibody (orb331414) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005249241

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TF-Coregulator CBP Interaction Plate Array II
FA-5032 2 Samples

TF-Coregulator CBP Interaction Plate Array II

Sign In for Pricing
View Details
3'-Deoxy-3'-fluoro-xyloadenosine
MBS5825839 Inquire

3'-Deoxy-3'-fluoro-xyloadenosine

Sign In for Pricing
View Details
CHRFAM7AP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV758999 1.0 µg DNA

CHRFAM7AP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
MKRN4P AAV Vector (Human) (CMV)
30176101 1 µg

MKRN4P AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Rabbit Monoclonal CD117/c-kit Antibody (007) [mFluor Violet 610 SE]
NBP2-89411MFV610 0.1 mL

Rabbit Monoclonal CD117/c-kit Antibody (007) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Mouse Monoclonal Gankyrin Antibody (1F4) [Alexa Fluor 532]
NBP2-59400AF532 0.1 mL

Mouse Monoclonal Gankyrin Antibody (1F4) [Alexa Fluor 532]

Sign In for Pricing
View Details