Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR10 Peptide - C-terminal region

MTMR10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MTMR10

UniProt

Q9NXD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTMR10 Rabbit Polyclonal Antibody (orb588000) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060232

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNGIISDQELLPRRNSLILKPKPDPAQQTDSQNSDTEQYFREWFSKPANL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(+/-) -Geosmin
FR162423-01 5 mg

(+/-) -Geosmin

Sign In for Pricing
View Details
(+/-) -Geosmin
FR162423-02 10 mg

(+/-) -Geosmin

Sign In for Pricing
View Details
(+/-) -Geosmin
FR162423-03 25 mg

(+/-) -Geosmin

Sign In for Pricing
View Details
(+/-) -Geosmin
FR162423-04 50 mg

(+/-) -Geosmin

Sign In for Pricing
View Details
(+/-) -Geosmin
FR162423-05 100 mg

(+/-) -Geosmin

Sign In for Pricing
View Details
Polyclonal Antibody to Eukaryotic Translation Elongation Factor 1 Epsilon 1 (EEF1e1)
MBS2112421-01 0.1 mL

Polyclonal Antibody to Eukaryotic Translation Elongation Factor 1 Epsilon 1 (EEF1e1)

Sign In for Pricing
View Details