Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR10 Peptide - C-terminal region

MTMR10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MTMR10

UniProt

Q9NXD2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTMR10 Rabbit Polyclonal Antibody (orb588000) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060232

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KNGIISDQELLPRRNSLILKPKPDPAQQTDSQNSDTEQYFREWFSKPANL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

eIF5A CRISPR Activation Plasmid (m2)
sc-435476-ACT-2 20 µg

eIF5A CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Recombinant Mouse Nuclear receptor coactivator 5 (Ncoa5)
MBS1471255-01 0.02 mg (E-Coli)

Recombinant Mouse Nuclear receptor coactivator 5 (Ncoa5)

Sign In for Pricing
View Details
Recombinant Mouse Nuclear receptor coactivator 5 (Ncoa5)
MBS1471255-02 0.02 mg (Yeast)

Recombinant Mouse Nuclear receptor coactivator 5 (Ncoa5)

Sign In for Pricing
View Details
Recombinant Mouse Nuclear receptor coactivator 5 (Ncoa5)
MBS1471255-03 0.1 mg (E-Coli)

Recombinant Mouse Nuclear receptor coactivator 5 (Ncoa5)

Sign In for Pricing
View Details
Recombinant Mouse Nuclear receptor coactivator 5 (Ncoa5)
MBS1471255-04 0.1 mg (Yeast)

Recombinant Mouse Nuclear receptor coactivator 5 (Ncoa5)

Sign In for Pricing
View Details
Recombinant Mouse Nuclear receptor coactivator 5 (Ncoa5)
MBS1471255-05 0.02 mg (Baculovirus)

Recombinant Mouse Nuclear receptor coactivator 5 (Ncoa5)

Sign In for Pricing
View Details