Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAMBPL1 Peptide - C-terminal region

STAMBPL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

STAMBPL1, AMSHLP, KIAA1373

UniProt

Q96FJ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STAMBPL1 Rabbit Polyclonal Antibody (orb588006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEGLRCVVLPED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMCO7 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
46835124 3x 1.0µg DNA

TMCO7 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Mouse Anti-KLH (Keyhole Limpet Hemocyanin) IgG ELISA kit
orb1715083-01 48 Tests

Mouse Anti-KLH (Keyhole Limpet Hemocyanin) IgG ELISA kit

Sign In for Pricing
View Details
Mouse Anti-KLH (Keyhole Limpet Hemocyanin) IgG ELISA kit
orb1715083-02 96 Tests

Mouse Anti-KLH (Keyhole Limpet Hemocyanin) IgG ELISA kit

Sign In for Pricing
View Details
SGSM3 Antibody
7037-01mg 0.1 mg

SGSM3 Antibody

Sign In for Pricing
View Details
3-epi-Oleanolic Acid
TRC-O520995-250MG 250 mg

3-epi-Oleanolic Acid

Sign In for Pricing
View Details
DRD1a Lentiviral Activation Particles (m2)
sc-420052-LAC-2 200 µL

DRD1a Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details