Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAMBPL1 Peptide - C-terminal region

STAMBPL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

STAMBPL1, AMSHLP, KIAA1373

UniProt

Q96FJ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STAMBPL1 Rabbit Polyclonal Antibody (orb588006) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEGLRCVVLPED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoclonal IL12B Antibody (ebdarokimab) [Janelia Fluor 669]
NBP3-28551JF669 0.1 mL

Human Monoclonal IL12B Antibody (ebdarokimab) [Janelia Fluor 669]

Sign In for Pricing
View Details
C5ar1 mouse monoclonal antibody, clone R63, PE
SM2103R 100 Tests

C5ar1 mouse monoclonal antibody, clone R63, PE

Sign In for Pricing
View Details
AP1S1 siRNA (Human)
orb1867421-01 15 nmol

AP1S1 siRNA (Human)

Sign In for Pricing
View Details
AP1S1 siRNA (Human)
orb1867421-02 30 nmol

AP1S1 siRNA (Human)

Sign In for Pricing
View Details
(S) -2-Amino-3- (5,6-dimethylpyridin-3-yl) propanoic acid dihydrochloride
OR1071236-01 50 mg

(S) -2-Amino-3- (5,6-dimethylpyridin-3-yl) propanoic acid dihydrochloride

Sign In for Pricing
View Details
(S) -2-Amino-3- (5,6-dimethylpyridin-3-yl) propanoic acid dihydrochloride
OR1071236-02 100 mg

(S) -2-Amino-3- (5,6-dimethylpyridin-3-yl) propanoic acid dihydrochloride

Sign In for Pricing
View Details