ZRANB3 Peptide - C-terminal region
ZRANB3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ZRANB3
UniProt
Q5FWF4
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZRANB3 Rabbit Polyclonal Antibody (orb588008) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YCEMCETPQGSAVMQIDSLNHIQDKNEKDDSQKDTSKKVQTISDCEKQAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Elab Fluor® 700 Anti-Human CD5 Antibody[HISM2]](https://cdn.genprice.uk/products/763/68dd14a1061270361e7d0ace/imageurl/e-ab-f1313m1.webp)
E-AB-F1313M1-01 20 Tests
Elab Fluor® 700 Anti-Human CD5 Antibody[HISM2]
Sign In for Pricing
View Details E-AB-F1313M1-02 100 Tests
Elab Fluor® 700 Anti-Human CD5 Antibody[HISM2]
Sign In for Pricing
View Details