ZRANB3 Peptide - C-terminal region
ZRANB3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ZRANB3
UniProt
Q5FWF4
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZRANB3 Rabbit Polyclonal Antibody (orb588008) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YCEMCETPQGSAVMQIDSLNHIQDKNEKDDSQKDTSKKVQTISDCEKQAL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TA367507 100 µL
GABA A Receptor beta 1 (GABRB1) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
GP-3901-40 1 mL
Colloidal Gold Conjugated Maclura pomifera Lectin (Osage Orange) -MPA-, 40nm
Sign In for Pricing
View Details 
TRC-B209970-250MG 250 mg
Benzyl 2-((2-((2-Acetoxybenzoyl)oxy)benzoyl)oxy)benzoate
Sign In for Pricing
View Details 
![Elab Fluor® 488 Anti-Human CD38 Antibody[HIT2]](https://cdn.genprice.uk/products/763/68dd14a9061270361e7d2445/imageurl/e-ab-f1058l.webp)
E-AB-F1058L-01 20 Tests
Elab Fluor® 488 Anti-Human CD38 Antibody[HIT2]
Sign In for Pricing
View Details