Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A30 Peptide - N-terminal region

SLC25A30 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SLC25A30, KMCP1

UniProt

Q5SVS4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC25A30 Rabbit Polyclonal Antibody (orb578927) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010875

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S1PR3 Mouse Monoclonal Antibody (FITC)
orb2973368-01 50 Tests

S1PR3 Mouse Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
S1PR3 Mouse Monoclonal Antibody (FITC)
orb2973368-02 100 Tests

S1PR3 Mouse Monoclonal Antibody (FITC)

Sign In for Pricing
View Details
FastClick™ Cy7 Azide
72704-AAT 1 mg

FastClick™ Cy7 Azide

Sign In for Pricing
View Details
5-Aminofluorescein Isomer I
A22150-01 1 g

5-Aminofluorescein Isomer I

Sign In for Pricing
View Details
5-Aminofluorescein Isomer I
A22150-02 5 g

5-Aminofluorescein Isomer I

Sign In for Pricing
View Details
Anti-PKNOX1 Antibody Picoband® Fluoro594 Conjugated
A07166-1-Fluoro594 100 µg/Vial

Anti-PKNOX1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details