Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A30 Peptide - N-terminal region

SLC25A30 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SLC25A30, KMCP1

UniProt

Q5SVS4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC25A30 Rabbit Polyclonal Antibody (orb578927) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001010875

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Angiotensin II Receptor 2, AT2R ELISA Kit
YLA2578HU-01 48 Tests

Human Angiotensin II Receptor 2, AT2R ELISA Kit

Sign In for Pricing
View Details
Human Angiotensin II Receptor 2, AT2R ELISA Kit
YLA2578HU-02 96 Tests

Human Angiotensin II Receptor 2, AT2R ELISA Kit

Sign In for Pricing
View Details
Recombinant Salmonella typhi Ecotin (eco)
MBS1426125-01 0.02 mg (E-Coli)

Recombinant Salmonella typhi Ecotin (eco)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Ecotin (eco)
MBS1426125-02 0.1 mg (E-Coli)

Recombinant Salmonella typhi Ecotin (eco)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Ecotin (eco)
MBS1426125-03 0.02 mg (Yeast)

Recombinant Salmonella typhi Ecotin (eco)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Ecotin (eco)
MBS1426125-04 0.1 mg (Yeast)

Recombinant Salmonella typhi Ecotin (eco)

Sign In for Pricing
View Details