Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IQCC Peptide - C-terminal region

IQCC Peptide - C-terminal region

Product Specifications

Product Name Alternative

IQCC

UniProt

Q4KMZ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IQCC Rabbit Polyclonal Antibody (orb587468) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HSVLDLWRTKPPKGQAPTDRSSRDGTSNEPSHEGQKKQRTIPWRSKSPEI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd80 Rat Monoclonal Antibody [Clone ID: RMMP-1]
AM31878RP-L 300 µg

Cd80 Rat Monoclonal Antibody [Clone ID: RMMP-1]

Sign In for Pricing
View Details
Human Microfibrillar Associated Protein 4 (MFAP4) ELISA Kit
RD-MFAP4-Hu-01 96 Tests

Human Microfibrillar Associated Protein 4 (MFAP4) ELISA Kit

Sign In for Pricing
View Details
Human Microfibrillar Associated Protein 4 (MFAP4) ELISA Kit
RD-MFAP4-Hu-02 48 Tests

Human Microfibrillar Associated Protein 4 (MFAP4) ELISA Kit

Sign In for Pricing
View Details
Frozen Tissue Sections, Metastasis, unknown source
CS621296 5x 5 µm

Frozen Tissue Sections, Metastasis, unknown source

Sign In for Pricing
View Details
Bisphenol A
TRC-B519495-10G 10 g

Bisphenol A

Sign In for Pricing
View Details
Frozen Tissue Sections, Rectum
CS636095 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details