IQCC Peptide - C-terminal region
IQCC Peptide - C-terminal region
Product Specifications
Product Name Alternative
IQCC
UniProt
Q4KMZ1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IQCC Rabbit Polyclonal Antibody (orb587468) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HSVLDLWRTKPPKGQAPTDRSSRDGTSNEPSHEGQKKQRTIPWRSKSPEI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MICA Mouse Monoclonal Antibody [A4C5]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea82518/imageurl/ha600002.webp)
BNC741234-500 1x 500 µL
Bcl-2 (100/D5 + 124), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941063-500 1x 500 µL
VEGF-A (VEGF/1063), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details