OR4S1 Peptide - C-terminal region
OR4S1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR4S1
UniProt
Q8NGB4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR4S1 Rabbit Polyclonal Antibody (orb587601) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001004725
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VVANSGMISLASFFILIISYVIILLNLRSQSSEDRRKAVSTCGSHVITVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741200-100 1x 100 µL
EGFR (GFR1195 + 31G7), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040382-100 1x 100 µL
Ep-CAM / CD326 (Rat) (GZ-20), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC403437-500 1x 500 µL
Desmocollin-2/3 (rDSC2/3437), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
