Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR4S1 Peptide - C-terminal region

OR4S1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR4S1

UniProt

Q8NGB4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR4S1 Rabbit Polyclonal Antibody (orb587601) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004725

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVANSGMISLASFFILIISYVIILLNLRSQSSEDRRKAVSTCGSHVITVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serum Amyloid A (SAA/2868R), CF488A conjugate, 0.1mg/mL
BNC882868-500 1x 500 µL

Serum Amyloid A (SAA/2868R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SFRS3 (SRSF3) (C-term) Rabbit Polyclonal Antibody
AP31722PU-N 50 µL

SFRS3 (SRSF3) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDPK1 (NM_031268) Human Recombinant Protein
TP306746 20 µg

PDPK1 (NM_031268) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant ZNF217 Antibody
RC-16196-01 50 μL

Recombinant ZNF217 Antibody

Sign In for Pricing
View Details
Recombinant ZNF217 Antibody
RC-16196-02 100 µL

Recombinant ZNF217 Antibody

Sign In for Pricing
View Details
Recombinant ZNF217 Antibody
RC-16196-03 1 mL

Recombinant ZNF217 Antibody

Sign In for Pricing
View Details