PGBD4 Peptide - C-terminal region
PGBD4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
PGBD4
UniProt
Q96DM1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PGBD4 Rabbit Polyclonal Antibody (orb331392) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_689808
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QNPTGRCKICCSQYDKDGKKIRKETRYFCAECDVPLCVVPCFEIYHTKKN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-0725R-RBITC 100 µL
Estrogen Receptor alpha Antibody, RBITC Conjugated
Sign In for Pricing
View Details PC108916 200 mg
(5-Fluoro-2-Nitrophenyl) (2,4,6-Trimethoxyphenyl) Iodonium P-Toluenesulfonate
Sign In for Pricing
View Details 
DZ41687-HRP 200 µL/Vial
Anti-Parhyale hawaiensis BMAL1 Antibody HRP Conjugated
Sign In for Pricing
View Details 040121-AP 200 µL
PLA2G6, ID (PLA2G6, IPLA2, 85kD calcium-independent phospholipase A2, Group VI phospholipase A2) (AP) discontinued
Sign In for Pricing
View Details 