Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PGBD4 Peptide - C-terminal region

PGBD4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PGBD4

UniProt

Q96DM1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PGBD4 Rabbit Polyclonal Antibody (orb331392) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689808

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QNPTGRCKICCSQYDKDGKKIRKETRYFCAECDVPLCVVPCFEIYHTKKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ARRB2 Protein, N-His
HB908022-01 50 µg

Recombinant Human ARRB2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ARRB2 Protein, N-His
HB908022-02 100 µg

Recombinant Human ARRB2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ARRB2 Protein, N-His
HB908022-03 1 mg

Recombinant Human ARRB2 Protein, N-His

Sign In for Pricing
View Details
Anti-SCIN Antibody (R2R65)
RHN78601 100 μg

Anti-SCIN Antibody (R2R65)

Sign In for Pricing
View Details
Phospho-Tau (Ser214) Antibody [M8H2]
C20298-50uL 50 μL

Phospho-Tau (Ser214) Antibody [M8H2]

Sign In for Pricing
View Details
ALX3 Polyclonal Antibody
MBS8521188-01 0.1 mg

ALX3 Polyclonal Antibody

Sign In for Pricing
View Details