Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REEP6 Peptide - C-terminal region

REEP6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

REEP6, C19orf32, DP1L1

UniProt

Q96HR9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with REEP6 Rabbit Polyclonal Antibody (orb327097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612402

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LYQRVVRPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVKPSQTPQPKDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sphingosine 1 Phosphate  Receptor 1 (EDG-1)
X1217C 100 µL

Sphingosine 1 Phosphate Receptor 1 (EDG-1)

Sign In for Pricing
View Details
CD79a
PR396-3ml 3 mL

CD79a

Sign In for Pricing
View Details
Mouse Cytoskeleton Associated Protein 2 (CKAP2) Antibody Pair Kit (with Standard)
MBS2101608-01 5x 96 Tests

Mouse Cytoskeleton Associated Protein 2 (CKAP2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Cytoskeleton Associated Protein 2 (CKAP2) Antibody Pair Kit (with Standard)
MBS2101608-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Cytoskeleton Associated Protein 2 (CKAP2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Cytoskeleton Associated Protein 2 (CKAP2) Antibody Pair Kit (with Standard)
MBS2101608-03 10x 96 Tests

Mouse Cytoskeleton Associated Protein 2 (CKAP2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Cytoskeleton Associated Protein 2 (CKAP2) Antibody Pair Kit (with Standard)
MBS2101608-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Cytoskeleton Associated Protein 2 (CKAP2) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details