Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REEP6 Peptide - C-terminal region

REEP6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

REEP6, C19orf32, DP1L1

UniProt

Q96HR9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with REEP6 Rabbit Polyclonal Antibody (orb327097) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612402

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LYQRVVRPLFLRHHGAVDRIMNDLSGRALDAAAGITRNVKPSQTPQPKDK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFATc4 Double Nickase Plasmid (h)
sc-417766-NIC 20 µg

NFATc4 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Human Six Transmembrane Epithelial Antigen Of The Prostate 2 (STEAP2) ELISA Kit
MBS453268-01 48 Tests

Human Six Transmembrane Epithelial Antigen Of The Prostate 2 (STEAP2) ELISA Kit

Sign In for Pricing
View Details
Human Six Transmembrane Epithelial Antigen Of The Prostate 2 (STEAP2) ELISA Kit
MBS453268-02 96 Tests

Human Six Transmembrane Epithelial Antigen Of The Prostate 2 (STEAP2) ELISA Kit

Sign In for Pricing
View Details
Human Six Transmembrane Epithelial Antigen Of The Prostate 2 (STEAP2) ELISA Kit
MBS453268-03 5x 96 Tests

Human Six Transmembrane Epithelial Antigen Of The Prostate 2 (STEAP2) ELISA Kit

Sign In for Pricing
View Details
Human Six Transmembrane Epithelial Antigen Of The Prostate 2 (STEAP2) ELISA Kit
MBS453268-04 10x 96 Tests

Human Six Transmembrane Epithelial Antigen Of The Prostate 2 (STEAP2) ELISA Kit

Sign In for Pricing
View Details
1- ((benzyloxy) methyl) -4-bromobenzene
OR1099887-01 250 mg

1- ((benzyloxy) methyl) -4-bromobenzene

Sign In for Pricing
View Details