Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REXO1L2P Peptide - N-terminal region

REXO1L2P Peptide - N-terminal region

Product Specifications

Product Name Alternative

REXO1L2P

UniProt

A0PJM3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSSPCLVTGYTDAKRTRVASSSQRSRGSKVGRQPGKTRNRSGMACKTTAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC2A2 Polyclonal Antibody
E-AB-15690-01 20 µL

SLC2A2 Polyclonal Antibody

Sign In for Pricing
View Details
SLC2A2 Polyclonal Antibody
E-AB-15690-02 60 µL

SLC2A2 Polyclonal Antibody

Sign In for Pricing
View Details
SLC2A2 Polyclonal Antibody
E-AB-15690-03 120 µL

SLC2A2 Polyclonal Antibody

Sign In for Pricing
View Details
SLC2A2 Polyclonal Antibody
E-AB-15690-04 200 µL

SLC2A2 Polyclonal Antibody

Sign In for Pricing
View Details
Wfdc12 (NM_138684) Mouse Tagged ORF Clone
MG200183 10 µg

Wfdc12 (NM_138684) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Di-O-cysteinyl-glycinoyl Curcumin 90%
TRC-D455600-1MG 1 mg

Di-O-cysteinyl-glycinoyl Curcumin 90%

Sign In for Pricing
View Details