Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

REXO1L2P Peptide - N-terminal region

REXO1L2P Peptide - N-terminal region

Product Specifications

Product Name Alternative

REXO1L2P

UniProt

A0PJM3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSSPCLVTGYTDAKRTRVASSSQRSRGSKVGRQPGKTRNRSGMACKTTAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®568 Tetrazine
#96055 1x 1 mg

CF®568 Tetrazine

Sign In for Pricing
View Details
Recombinant Human IL-25 Protein (Halo Tag)
PDMH100460-01 20 µg

Recombinant Human IL-25 Protein (Halo Tag)

Sign In for Pricing
View Details
Recombinant Human IL-25 Protein (Halo Tag)
PDMH100460-02 100 µg

Recombinant Human IL-25 Protein (Halo Tag)

Sign In for Pricing
View Details
Recombinant Human IL-25 Protein (Halo Tag)
PDMH100460-03 500 µg

Recombinant Human IL-25 Protein (Halo Tag)

Sign In for Pricing
View Details
Recombinant Human IL-25 Protein (Halo Tag)
PDMH100460-04 1 mg

Recombinant Human IL-25 Protein (Halo Tag)

Sign In for Pricing
View Details
CD162 Antibody / P selectin glycoprotein ligand 1 / PSGL-1
RQ5684 100 µg

CD162 Antibody / P selectin glycoprotein ligand 1 / PSGL-1

Sign In for Pricing
View Details