Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RMND5A Peptide - middle region

RMND5A Peptide - middle region

Product Specifications

Product Name Alternative

RMND5A

UniProt

Q9H871

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RMND5A Rabbit Polyclonal Antibody (orb327101) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073617

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDVAEELCQESGLSVDPSQKEPFVELNRILEALKVRVLRPALEWAVSNRE

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin H Recombinant Antibody, APC Conjugated
bsm-62785R-APC-TR 20 µL

Cathepsin H Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
PABPC1P5 Adenovirus (Human)
35902051 1.0 mL

PABPC1P5 Adenovirus (Human)

Sign In for Pricing
View Details
Recombinant Mouse MARCO Protein, N-8*His
EMJ74701 100 μg

Recombinant Mouse MARCO Protein, N-8*His

Sign In for Pricing
View Details
GFAP Polyclonal Guinea pig antiserum
173 004 100 µL

GFAP Polyclonal Guinea pig antiserum

Sign In for Pricing
View Details
2-Deoxy-D-ribose
D3202-01 1 g

2-Deoxy-D-ribose

Sign In for Pricing
View Details
Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1591), CF594 conjugate, 0.1mg/mL
BNC941591-500 1x 500 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (THBD/1591), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details