RMND5A Peptide - middle region
RMND5A Peptide - middle region
Product Specifications
Product Name Alternative
RMND5A
UniProt
Q9H871
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RMND5A Rabbit Polyclonal Antibody (orb327101) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_073617
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LDVAEELCQESGLSVDPSQKEPFVELNRILEALKVRVLRPALEWAVSNRE
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal Doublecortin Antibody (3E1) [Alexa Fluor 405]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
NBP1-92684AF405 0.1 mL
Mouse Monoclonal Doublecortin Antibody (3E1) [Alexa Fluor 405]
Sign In for Pricing
View Details OABF01247-100UL 100 µL
NTRK1 Antibody (Phospho-Tyr496) (OABF01247-100UL)
Sign In for Pricing
View Details 
MBS1323002-01 0.02 mg (E-Coli)
Recombinant Staphylococcus aureus Transcriptional regulator sarA (sarA)
Sign In for Pricing
View Details MBS1323002-02 0.1 mg (E-Coli)
Recombinant Staphylococcus aureus Transcriptional regulator sarA (sarA)
Sign In for Pricing
View Details MBS1323002-03 0.02 mg (Yeast)
Recombinant Staphylococcus aureus Transcriptional regulator sarA (sarA)
Sign In for Pricing
View Details MBS1323002-04 0.1 mg (Yeast)
Recombinant Staphylococcus aureus Transcriptional regulator sarA (sarA)
Sign In for Pricing
View Details