Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROGDI Peptide - N-terminal region

ROGDI Peptide - N-terminal region

Product Specifications

Product Name Alternative

ROGDI

UniProt

Q9GZN7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ROGDI Rabbit Polyclonal Antibody (orb587741) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078865

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Calcitonin, CT ELISA Kit
CSB-E05131h-01 48 Tests

Human Calcitonin, CT ELISA Kit

Sign In for Pricing
View Details
Human Calcitonin, CT ELISA Kit
CSB-E05131h-02 96 Tests

Human Calcitonin, CT ELISA Kit

Sign In for Pricing
View Details
Human Calcitonin, CT ELISA Kit
CSB-E05131h-03 5x 96 Tests

Human Calcitonin, CT ELISA Kit

Sign In for Pricing
View Details
Human Calcitonin, CT ELISA Kit
CSB-E05131h-04 10x 96 Tests

Human Calcitonin, CT ELISA Kit

Sign In for Pricing
View Details
GIGYF1 Protein Vector (Human) (pPM-C-His)
PV080584 500 ng

GIGYF1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Cyclin T2 Rabbit Polyclonal Antibody
MBS9512297-01 0.05 mL

Cyclin T2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details