Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ROGDI Peptide - N-terminal region

ROGDI Peptide - N-terminal region

Product Specifications

Product Name Alternative

ROGDI

UniProt

Q9GZN7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ROGDI Rabbit Polyclonal Antibody (orb587741) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078865

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHAVLKQLQDILKEASLRFTLPGSGTEGPAKQENFILGSCGTDQVKGVLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIF21A Polyclonal Antibody
29876-01 50 µL

KIF21A Polyclonal Antibody

Sign In for Pricing
View Details
KIF21A Polyclonal Antibody
29876-02 100 µL

KIF21A Polyclonal Antibody

Sign In for Pricing
View Details
SOX6 Antibody - middle region : HRP (ARP39760_P050-HRP)
ARP39760_P050-HRP 100 µL

SOX6 Antibody - middle region : HRP (ARP39760_P050-HRP)

Sign In for Pricing
View Details
YicR Antibody
orb836425 2 mg

YicR Antibody

Sign In for Pricing
View Details
TSSK 2 (h) -PR
sc-76768-PR 10 µM - 20 µL

TSSK 2 (h) -PR

Sign In for Pricing
View Details
Ub Polyclonal Antibody
MBS9246048-01 0.1 mL

Ub Polyclonal Antibody

Sign In for Pricing
View Details