Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRRM3 Peptide - N-terminal region

SRRM3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SRRM3

UniProt

F5GYC8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRRM3 Rabbit Polyclonal Antibody (orb587757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AHREILDHERKRRVELKCMELQEMMEEQGYSEEEIRQKVGTFRQMLMEKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-20R alpha, Mouse (HEK293, Fc)
HY-P77965-01 20 µg

IL-20R alpha, Mouse (HEK293, Fc)

Sign In for Pricing
View Details
IL-20R alpha, Mouse (HEK293, Fc)
HY-P77965-02 50 µg

IL-20R alpha, Mouse (HEK293, Fc)

Sign In for Pricing
View Details
Recombinant Human Calreticulin/CALR Protein, C-His
orb2966655-01 50 µg

Recombinant Human Calreticulin/CALR Protein, C-His

Sign In for Pricing
View Details
Recombinant Human Calreticulin/CALR Protein, C-His
orb2966655-02 100 µg

Recombinant Human Calreticulin/CALR Protein, C-His

Sign In for Pricing
View Details
Recombinant Human Calreticulin/CALR Protein, C-His
orb2966655-03 1 mg

Recombinant Human Calreticulin/CALR Protein, C-His

Sign In for Pricing
View Details
CNOT8, CT (CCR4-NOT Transcription Complex Subunit 8, CCR4-associated Factor 8, CAF1-like Protein, CALIFp, CAF2, POP2, CALIF) (AP) discontinued
C2099-68Z-AP 200 µL

CNOT8, CT (CCR4-NOT Transcription Complex Subunit 8, CCR4-associated Factor 8, CAF1-like Protein, CALIFp, CAF2, POP2, CALIF) (AP) discontinued

Sign In for Pricing
View Details