Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRRM3 Peptide - N-terminal region

SRRM3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SRRM3

UniProt

F5GYC8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SRRM3 Rabbit Polyclonal Antibody (orb587757) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AHREILDHERKRRVELKCMELQEMMEEQGYSEEEIRQKVGTFRQMLMEKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARNTL2 Antibody
MBS9414013-01 0.1 mL

ARNTL2 Antibody

Sign In for Pricing
View Details
ARNTL2 Antibody
MBS9414013-02 5x 0.1 mL

ARNTL2 Antibody

Sign In for Pricing
View Details
Hsa-miR-4439 agomir
HY-R01043A-01 5 nmol

Hsa-miR-4439 agomir

Sign In for Pricing
View Details
Hsa-miR-4439 agomir
HY-R01043A-02 20 nmol

Hsa-miR-4439 agomir

Sign In for Pricing
View Details
Protease and Phosphatase Inhibitor Cocktail (EDTA Free, 100X in ddH2O)
K4006-50 50x 1 mL

Protease and Phosphatase Inhibitor Cocktail (EDTA Free, 100X in ddH2O)

Sign In for Pricing
View Details
ICMT Polyclonal Antibody, PE-Cy5 Conjugated
bs-8019R-PE-Cy5 100 µL

ICMT Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details