Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TBKBP1 Peptide - C-terminal region

TBKBP1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TBKBP1, KIAA0775

UniProt

A7MCY6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TBKBP1 Rabbit Polyclonal Antibody (orb587765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005257919

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPRRAFEGIRLRFEKQPSEEDEWAVPTSPPSPEVGTIRCASFCAGFPIPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chordc1 Mouse Gene Knockout Kit (CRISPR)
KN503288 1 Kit

Chordc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TAZ (WWTR1) (NM_015472) Human Recombinant Protein
TP304082 20 µg

TAZ (WWTR1) (NM_015472) Human Recombinant Protein

Sign In for Pricing
View Details
Ki67 (MKI67) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI18G5]
TA803157AM 100 µL

Ki67 (MKI67) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI18G5]

Sign In for Pricing
View Details
Human PPP1R12C activation kit by CRISPRa
GA110255 1 Kit

Human PPP1R12C activation kit by CRISPRa

Sign In for Pricing
View Details
Tyrosine Hydroxylase (TH) Human Gene Knockout Kit (CRISPR)
KN211218 1 Kit

Tyrosine Hydroxylase (TH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPR34 (Center) Rabbit Polyclonal Antibody
AP51926PU-N 400 µL

GPR34 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details