Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TECPR1 Peptide - N-terminal region

TECPR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TECPR1, KIAA1358

UniProt

Q7Z6L1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TECPR1 Rabbit Polyclonal Antibody (orb587769) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005250311

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YTKDKKWNSCVRRRKWIRYRRYKSRDIWAKIPSKDDPKELPDPFNDLSVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP13 (NM_002427) Human Over-expression Lysate
LY400869 100 µg

MMP13 (NM_002427) Human Over-expression Lysate

Sign In for Pricing
View Details
Angiotensin II Trifluoroacetic Acid Salt (Human)
TRC-A637965-50MG 50 mg

Angiotensin II Trifluoroacetic Acid Salt (Human)

Sign In for Pricing
View Details
Myc tag Recombinant Mouse Monoclonal Antibody [A3C8-R-2]
HA601081 100 µL

Myc tag Recombinant Mouse Monoclonal Antibody [A3C8-R-2]

Sign In for Pricing
View Details
Glyoxal Sodium Bisulfite (contains oligomers)
TRC-G754513-5G 5 g

Glyoxal Sodium Bisulfite (contains oligomers)

Sign In for Pricing
View Details
NR2C2 Mouse Monoclonal Antibody [Clone ID: OTI7E12]
CF807249 100 µg

NR2C2 Mouse Monoclonal Antibody [Clone ID: OTI7E12]

Sign In for Pricing
View Details
Nucleolar / Nucleoli (NM95), 0.2mg/mL
BNUB0095-500 1x 500 µL

Nucleolar / Nucleoli (NM95), 0.2mg/mL

Sign In for Pricing
View Details