Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TECPR1 Peptide - N-terminal region

TECPR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TECPR1, KIAA1358

UniProt

Q7Z6L1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TECPR1 Rabbit Polyclonal Antibody (orb587769) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005250311

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YTKDKKWNSCVRRRKWIRYRRYKSRDIWAKIPSKDDPKELPDPFNDLSVG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS510302 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
IGF1 (NM_000618) Human Recombinant Protein
TP720023M 50 µg

IGF1 (NM_000618) Human Recombinant Protein

Sign In for Pricing
View Details
1-Bromonaphthalen-2-ol
TRC-B686018-500MG 500 mg

1-Bromonaphthalen-2-ol

Sign In for Pricing
View Details
FXYD6 (NM_001164832) Human Over-expression Lysate
LC431748 20 µg

FXYD6 (NM_001164832) Human Over-expression Lysate

Sign In for Pricing
View Details
Prolyl Endopeptidase (PREP) (NM_002726) Human Over-expression Lysate
LC400960 20 µg

Prolyl Endopeptidase (PREP) (NM_002726) Human Over-expression Lysate

Sign In for Pricing
View Details
CRALBP (RLBP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H5]
TA503185BM 100 µL

CRALBP (RLBP1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H5]

Sign In for Pricing
View Details